PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.026590.1
Common NameCsa_5G092920, LOC101208745
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family BBR-BPC
Protein Properties Length: 278aa    MW: 30995.7 Da    PI: 10.5157
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.026590.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind313.38.3e-9612771301
       GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd.........maflqrdkalaernkalverdnkll 82 
                     md d+ + rn+gyyep+  lk +lglqlms+i erd k     r+  + + + +aa+++r+          ++  rd ++++        ++kl+
  Cucsa.026590.1   1 MDGDALNMRNWGYYEPS--LKAHLGLQLMSTIGERDVKHfmpgRDPSA-IVNMNAAFHPREsvvseapvvTNW-ARDGWINH--------RDKLF 83 
                     99999988*******99..*******************9999766665.9***********888888886566.78888888........67888 PP

       GAGA_bind  83 alllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkk 177
                     ++l  ++s        ++ l +t+ ++ lq      l+  + ++++ e   +l+ie +++++k +k++kkrq++  pk++k kk++k  +    k
  Cucsa.026590.1  84 NVLSPNTS--------YSLLAETSAAQPLQI-----LQ--PLDTSRDE--MVLKIE-EPPVKKGTKQPKKRQNGGAPKTPKPKKPRK--P----K 154
                     88886665........889999999999988.....33..34433444..345554.48889999999*****************99..2....2 PP

       GAGA_bind 178 vkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekL 272
                     ++ +s+ +++ka+kk+++lv+ng ++D+s++P+PvCsCtG+++qCY+WG GGWqSaCCtt++S +PLP+s krrgaRiagrKmSqgafkk+LekL
  Cucsa.026590.1 155 NNDPSV-QQVKAPKKKMELVINGFDMDISSIPIPVCSCTGTPHQCYRWGYGGWQSACCTTSLSLHPLPMSEKRRGARIAGRKMSQGAFKKVLEKL 248
                     333443.579************************************************************************************* PP

       GAGA_bind 273 aaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     aa+Gy++snp+DL++hWA+HGtnkfvtir
  Cucsa.026590.1 249 AAQGYNFSNPIDLRSHWARHGTNKFVTIR 277
                     ****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.3E-1471277IPR010409GAGA-binding transcriptional activator
PfamPF062179.4E-1052277IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MDGDALNMRN WGYYEPSLKA HLGLQLMSTI GERDVKHFMP GRDPSAIVNM NAAFHPRESV  60
VSEAPVVTNW ARDGWINHRD KLFNVLSPNT SYSLLAETSA AQPLQILQPL DTSRDEMVLK  120
IEEPPVKKGT KQPKKRQNGG APKTPKPKKP RKPKNNDPSV QQVKAPKKKM ELVINGFDMD  180
ISSIPIPVCS CTGTPHQCYR WGYGGWQSAC CTTSLSLHPL PMSEKRRGAR IAGRKMSQGA  240
FKKVLEKLAA QGYNFSNPID LRSHWARHGT NKFVTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150151.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
SwissprotQ9SKD09e-95BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A0A0KLI80.0A0A0A0KLI8_CUCSA; Uncharacterized protein
STRINGVIT_01s0011g06380.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.33e-92basic pentacysteine 2
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]